DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:130 Identity:45/130 - (34%)
Similarity:66/130 - (50%) Gaps:6/130 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMASGGNLKGA 72
            ||.|..||..||..|..|:..:..|...|..:|:.......|:|.... :|||: .|..|.:.|.
plant    43 QETLVVHNKARAMVGVGPMVWNETLATYAQSYAHERARDCAMKHSLGP-FGENL-AAGWGTMSGP 105

  Fly    73 DAVRSWYEEIRQYNWNSPSFQGN--TGHFTQVVWKSSTELGVGF--AKSGSTIYVVCNYNPPGNY 133
            .|...|..|...|:::|.:..|:  .||:||:||:.|..||...  .|:...|:|:|:|:|||||
plant   106 VATEYWMTEKENYDYDSNTCGGDGVCGHYTQIVWRDSVRLGCASVRCKNDEYIWVICSYDPPGNY 170

  Fly   134  133
            plant   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 38/120 (32%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 45/130 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.