DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and AT2G19980

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:135 Identity:43/135 - (31%)
Similarity:59/135 - (43%) Gaps:19/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMASG-----GN 68
            |.|..||..||        ...||...|..:||.......|::..:..|||||  |:|     ..
plant    37 ETLAVHNQIRA--------ADQKLAAHAQRYANVRSQDCAMKYSTDGTYGENI--AAGWVQPMDT 91

  Fly    69 LKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAK--SGSTIYVVCNY--NP 129
            :.|..|.:.|:.|...||:.:.......||:||:|...||.||.|..:  ....::|||||  .|
plant    92 MSGPIATKFWFTEKPYYNYATNKCSEPCGHYTQIVANQSTHLGCGTVRCFKNEYVWVVCNYAPRP 156

  Fly   130 PGNYN 134
            .|:.|
plant   157 MGDAN 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 36/122 (30%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 43/135 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.