DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and AT2G19970

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_179587.1 Gene:AT2G19970 / 816516 AraportID:AT2G19970 Length:177 Species:Arabidopsis thaliana


Alignment Length:138 Identity:42/138 - (30%)
Similarity:60/138 - (43%) Gaps:23/138 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSR---------NRMEHRQNSGYGENIYM 63
            ::.|:.||..||..|..||    |.|:....:|....:|         :.|.| .:..|||||  
plant    36 RKTLKVHNQIRAAVGVAPL----KWNKTVAAYAQKFANRQAKAGVCDYSSMRH-SDGPYGENI-- 93

  Fly    64 ASG-----GNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAK--SGSTI 121
            |:|     ..:.|..|.:.|..|...|:..:...:...||:||:|...|..||.|..:  ....|
plant    94 AAGWVQPKDQMSGPIAAKYWLTEKPNYDHATNKCKDVCGHYTQMVANQSLSLGCGSFRCHENELI 158

  Fly   122 YVVCNYNP 129
            |:||||.|
plant   159 YIVCNYYP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 37/132 (28%)
AT2G19970NP_179587.1 CAP_PR-1 35..177 CDD:349400 42/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.