DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and PR1

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:137 Identity:52/137 - (37%)
Similarity:70/137 - (51%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSG--YGENIYMAS 65
            ||...|:.|:.||..|...|..|:....::...|..:|..|....|:.|   ||  ||||:...|
plant    26 AQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGNCRLIH---SGGPYGENLAWGS 87

  Fly    66 GGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAK--SGSTIYVVCNYN 128
             |:|.|..||..|..|...||:.:.:..|..||:|||||:.|..||....:  :|.|| :.|||:
plant    88 -GDLSGVSAVNMWVSEKANYNYAANTCNGVCGHYTQVVWRKSVRLGCAKVRCNNGGTI-ISCNYD 150

  Fly   129 PPGNYNN 135
            |.|||.|
plant   151 PRGNYVN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 42/123 (34%)
PR1NP_179068.1 SCP_PR-1_like 30..161 CDD:240181 50/133 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.