DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and PRB1

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:137 Identity:54/137 - (39%)
Similarity:77/137 - (56%) Gaps:5/137 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMAS 65
            :.||..:|:.:.|||..|::.|..|:.....|...|..:||.|....|:.|.:.. ||||: ..|
plant    24 LKAQDSQQDYVNAHNQARSQIGVGPMQWDEGLAAYARNYANQLKGDCRLVHSRGP-YGENL-AKS 86

  Fly    66 GGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAK--SGSTIYVVCNYN 128
            ||:|.|..||..|..|...||:::.:..|..||:|||||::|..||....:  :|.|| :.|||:
plant    87 GGDLSGVAAVNLWVNEKANYNYDTNTCNGVCGHYTQVVWRNSVRLGCAKVRCNNGGTI-ISCNYD 150

  Fly   129 PPGNYNN 135
            |||||.|
plant   151 PPGNYAN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 43/121 (36%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 52/131 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3501
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.