DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Crisp4

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:150 Identity:38/150 - (25%)
Similarity:66/150 - (44%) Gaps:28/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWAN------YLLSR-------NRMEHR-QNSGY 57
            ::|::..||.:|.|  ..|    |..|.|...|::      .:|:|       :.:|.| .|:..
Mouse    85 QEEIVNTHNAFRRK--VSP----PARNMLKVSWSSAAAENARILARYCDKSDSDSLERRLPNTFC 143

  Fly    58 GENIYMASGGNLKGADAVRSWYEEIRQY---NWNSPSFQGNTGHFTQVVWKSSTELGVGFA---- 115
            |||:.|....: ..:..:..|:.|.:.:   .|.|......|.|:||:||.|:..:|...|    
Mouse   144 GENMLMEHYPS-SWSKVIEIWFNESKYFKYGEWPSTDDDIETDHYTQMVWASTYLVGCDVAACRR 207

  Fly   116 KSGSTIYVVCNYNPPGNYNN 135
            :..:|...||:|...||:.:
Mouse   208 QKAATYLYVCHYCHEGNHQD 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 33/138 (24%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.