DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Pi16

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:144 Identity:39/144 - (27%)
Similarity:66/144 - (45%) Gaps:24/144 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRM--------EHRQNSGYGENIYM 63
            :|.::..||.|||:  ..|    |..:.|...|.:.|.:..:.        .:::....|||::.
Mouse    35 KQTMVDLHNQYRAQ--VSP----PASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFA 93

  Fly    64 ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGN--TGHFTQVVWKSSTELGVGF--------AKSG 118
            .:...:....||.:|:||...||:::.:...|  .||:|||||..:..:|.|.        .:..
Mouse    94 ITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEA 158

  Fly   119 STIYVVCNYNPPGN 132
            :...:||||.||||
Mouse   159 NIHLLVCNYEPPGN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 31/135 (23%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 34/138 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.