DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:150 Identity:45/150 - (30%)
Similarity:69/150 - (46%) Gaps:26/150 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFEQEVLQAHNLYRAKHGAQP-------LTLSPKLNRLATEW------ANYLLSRNRMEHRQNSG 56
            :|....|..||..|.|  .||       |....:|.:||..|      |:....:.|.|..::..
Mouse    40 KFIDAFLNIHNELRRK--VQPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYD 102

  Fly    57 Y-GENIYMASGGNL--KGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFA--- 115
            : |||||:   |.:  :..|.|.:||.|.:.:|::..:.....||:|||||..:.::|...:   
Mouse   103 FIGENIYL---GRIETQPEDVVINWYNESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAVSNCP 164

  Fly   116 --KSGSTIYVVCNYNPPGNY 133
              |..|....||||:|.||:
Mouse   165 NLKGFSAGLFVCNYSPAGNF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 38/140 (27%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 42/145 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841190
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.