DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Glipr1l2

DIOPT Version :10

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:121 Identity:35/121 - (28%)
Similarity:57/121 - (47%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LTLSPKLNRLATEWA-NYLLSRN------RMEHRQNSGYGENIYMASGGNLKGADAVRSWYEEIR 83
            :|....|:|.|..|. ..:.|||      ...|...:..|||:::....:.....|:|||:||.:
Mouse    75 MTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGENMWVGPVEDFTVTTAIRSWHEERK 139

  Fly    84 QYNW-NSPSFQG-NTGHFTQVVWKSSTELG---VGFAKSGSTIYV---VCNYNPPG 131
            .|:: |....:. |..|:.|:||.||.::|   ...|::|...:.   :|||.|.|
Mouse   140 SYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGGFTHAALFICNYAPGG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 CAP_GAPR1-like 5..125 CDD:349401 30/113 (27%)
Glipr1l2NP_080499.1 CAP 49..195 CDD:412178 34/119 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.