DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Crisp3

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:146 Identity:41/146 - (28%)
Similarity:69/146 - (47%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAKHGAQPLTLSPKLNRL------------ATEWAN-YLLSRNRMEHRQNS-GY 57
            ::|::..||..|.       |:||..:.|            |.:||| .:.:.:.::||..: ..
  Rat    41 QEEIINKHNQLRR-------TVSPSGSDLLRVEWDHDAYVNAQKWANRCIYNHSPLQHRTTTLKC 98

  Fly    58 GENIYMASGGNLKGADAVRSWYEEIRQYNWN-SPSFQG-NTGHFTQVVWKSSTELGVGFAKSGS- 119
            |||::||: .....:..::.||:|...:.:. .|...| ..||:|||||.|:..:..|.|:... 
  Rat    99 GENLFMAN-YPASWSSVIQDWYDESLDFVFGFGPKKVGVKVGHYTQVVWNSTFLVACGVAECPDQ 162

  Fly   120 --TIYVVCNYNPPGNY 133
              ..:.||:|.|.|||
  Rat   163 PLKYFYVCHYCPGGNY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 34/136 (25%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 37/140 (26%)
Crisp 192..246 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.