DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and crispld2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:156 Identity:42/156 - (26%)
Similarity:75/156 - (48%) Gaps:34/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNS---GYGENIYM 63
            ::|::|.||..|.:     ...:.:|...:|.:.|..||...:    .||...:   ..|:|:.:
 Frog    57 KEEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEECI----WEHGPTALLMSIGQNLAV 117

  Fly    64 ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGN-------TG----HFTQVVWKSSTELG--VGFA 115
            ..|...:.|..|:|||:|::.|.:..| .:.|       :|    |:||:||.::|::|  |...
 Frog   118 HWGRYRQPAYHVQSWYDEVKDYTYPYP-HECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVC 181

  Fly   116 KS--------GSTIYVVCNYNPPGNY 133
            |.        .:.:|:||||:|.||:
 Frog   182 KRMNVWGDIWENAVYLVCNYSPKGNW 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 35/146 (24%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 38/149 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.