DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and crispl

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:148 Identity:46/148 - (31%)
Similarity:69/148 - (46%) Gaps:24/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QEVLQAHNLYRAKHGAQP-----LTLSPKLNRLATEWANYLLSRNRME-HRQNSGY--GENIYMA 64
            |.:|..||..|......|     :..|....:.|.:|||.....:.:: .|...|:  |||::||
 Frog   109 QSILNVHNELRRNANPPPSNMLKMVWSDLAAKSAAKWANSCKQYHSLKPERTIPGFSCGENLFMA 173

  Fly    65 SGGNLKGA--DAVRSWYEEIRQYNWNSPSFQGNTG----HFTQVVWKSSTELGVGFAKSGST--- 120
            |   .|.:  |.:|::|.||..:.:...:.:  .|    |||||:|.||..:|...|:...|   
 Frog   174 S---YKASWEDVIRAFYSEIEDFLYGKGAKE--VGLQILHFTQVMWFSSWLVGCAAAQCPITDHS 233

  Fly   121 --IYVVCNYNPPGNYNNL 136
              .|.||:|.|.|||.|:
 Frog   234 LEFYFVCHYAPAGNYGNV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 38/135 (28%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 41/140 (29%)
Crisp 261..314 CDD:369954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.