DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and r3hdml

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:140 Identity:37/140 - (26%)
Similarity:62/140 - (44%) Gaps:18/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMASGGNL 69
            :|..||..|::     ...:.:....:|.:.|..||:..:..:...|.... .|:|:.:.||...
Zfish    69 LLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH-IGQNLSIISGRYK 132

  Fly    70 KGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKSGSTIYV----------- 123
            ...|.|:|||:|...:::.|........|:||:||.:|.::|....|. |.|:|           
Zfish   133 SIIDLVKSWYDERHSFSYPSRCSGSVCTHYTQMVWAASNKIGCAIKKC-SDIFVFGSMWKQATLL 196

  Fly   124 VCNYNPPGNY 133
            ||||...||:
Zfish   197 VCNYAIKGNW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 31/130 (24%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.