DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:150 Identity:47/150 - (31%)
Similarity:67/150 - (44%) Gaps:26/150 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFEQEVLQAHNLYRAKHGAQP-------LTLSPKLNRLATEWANYL-LSRN---RMEHRQNSGY- 57
            :|:...|.:||  .|:...||       |:....|.:||..|.... .|.|   ...|.....| 
  Rat    40 EFKNGFLNSHN--EARRKVQPPASNMNQLSWDKSLAKLAKSWTRECKFSHNPCTSKRHGCTKDYD 102

  Fly    58 --GENIYMASGGNL--KGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAK-- 116
              |||||:   |.:  :..|.|.|||.|.:.||::..:.....||:|||||..:.::|...:.  
  Rat   103 YIGENIYL---GKIDARPEDVVFSWYNETKDYNFDDNTCTKTCGHYTQVVWAKTLKIGCAISNCP 164

  Fly   117 --SG-STIYVVCNYNPPGNY 133
              :| |....||||.|.||:
  Rat   165 HLTGYSAGLFVCNYVPAGNF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 40/140 (29%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 44/145 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344594
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.