DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and glipr2l

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001005978.1 Gene:glipr2l / 449805 ZFINID:ZDB-GENE-041010-53 Length:154 Species:Danio rerio


Alignment Length:150 Identity:68/150 - (45%)
Similarity:84/150 - (56%) Gaps:9/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNS---GYGENIYM 63
            :::.|.:|.|:.||.||.||.|.||.||.||...|:.:|..|.|...::|...|   ..|||:..
Zfish     5 ASRLFSEEALKTHNEYRRKHQAPPLKLSSKLCSEASRYAESLASTRILKHSVESSRGNCGENLAW 69

  Fly    64 ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVG--FAKSGSTIYVVCN 126
            || .:..|.|....||.|:.|||:|.|.|...|||||.||||.|.:||||  .|..||| :||..
Zfish    70 AS-YDQTGKDVTDRWYNEVNQYNFNQPGFSSGTGHFTAVVWKGSKKLGVGKAVASDGST-FVVAR 132

  Fly   127 YNPPGNYNNL--FRENVAPP 144
            |.|.||..|.  |:.||.||
Zfish   133 YFPAGNITNQGHFQANVLPP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 57/124 (46%)
glipr2lNP_001005978.1 SCP_GAPR-1_like 9..139 CDD:240182 61/131 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.