DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Ag5r

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:208 Identity:51/208 - (24%)
Similarity:69/208 - (33%) Gaps:87/208 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAH-NLYRAKH--GAQPLTLSPKLNRLATEWAN---YLLSRN----RMEHRQNSGYGENI 61
            |::.|.|. |.|| .|  |.....||........:|.:   ||.|.|    :|:|  :..:..:.
  Fly    58 EKDALVARTNEYR-NHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKH--DGCHNTDA 119

  Fly    62 YMASGGNLK----------------GADAVRSWYEE--------IRQY--NWNSPSFQGNTGHFT 100
            :..||.||.                |.|   .||:|        |..|  |:|.|:.    ||||
  Fly   120 FDWSGQNLAWMGYYNPLNVTHYLEWGVD---MWYDEAVYTKQAYIDAYPSNYNGPAI----GHFT 177

  Fly   101 QVVWKSSTELGVGFA------KSGSTIYVVCNY-------------------------NPPGNY- 133
            .:|...:||:|...|      :|.....:.|||                         ||...| 
  Fly   178 VLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYL 242

  Fly   134 ---------NNLF 137
                     ||||
  Fly   243 CSAKEEYNVNNLF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 41/159 (26%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455099
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.