DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG11977

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:100 Identity:19/100 - (19%)
Similarity:37/100 - (37%) Gaps:32/100 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QNSGYGENIYMASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGH---------FTQVVWKSST 108
            ||:..|.|:          ...:..|:|   .:....||:..|..:         |..::::.:.
  Fly   155 QNTSKGFNV----------ISFLNMWFE---YHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNK 206

  Fly   109 ELGVGFAKSGSTIYVVCNYNPPGNYNNLFRENVAP 143
            ::|.|..|||...::.|          ||.:.:.|
  Fly   207 KMGCGMVKSGQGRFLTC----------LFDKKIKP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 15/80 (19%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.