DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG31482

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster


Alignment Length:143 Identity:59/143 - (41%)
Similarity:86/143 - (60%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSG--YGENIYMASGGNL 69
            :::.|..||..|.|||:.||||..:|.:...|:|..|.:..::||..::|  ||||:.|.|...|
  Fly    23 QEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRSQTPL 87

  Fly    70 KGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKSGSTIY-VVCNYNPPGNY 133
            :   .|:.||:||..|::..|.|..:|||||.:|||::.::|:|.||.....| ||..|.||.|.
  Fly    88 Q---CVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNV 149

  Fly   134 NNLFRENVAPPMQ 146
            |..|.|||.||::
  Fly   150 NGQFEENVLPPIK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 47/120 (39%)
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 51/128 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455000
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
1211.830

Return to query results.
Submit another query.