DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG42564

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:158 Identity:33/158 - (20%)
Similarity:58/158 - (36%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYR---AKHGAQPLTLSPKLNRLATEW---ANYLLSRN------RMEHRQNSGYGE 59
            |:.:|:..|..|   ||.|...|:.:.::..|  :|   ..||...|      |.:..:|:.:.:
  Fly    94 ERFLLRRFNELRDSVAKGGFNGLSPASRMGTL--KWNPELAYLAEFNVRDCVLRHDECRNTKFTQ 156

  Fly    60 NIYMASG-GNLKG---------ADAVRSWYEE--------IRQY---NWNSPSFQGNTGHFTQVV 103
            |.....| ..:||         .|.:..|..|        |.:|   ...||.:     :|.|:|
  Fly   157 NAGQTVGYRGIKGKLPELEDILRDIIGVWLREKSRTSMVNIMKYVEQESQSPKY-----NFLQIV 216

  Fly   104 WKSSTELGVGFAKSGS----TIYVVCNY 127
            .:::..:|....:...    ..:..|||
  Fly   217 LENAESVGCAIVQQSRHGWIQTFFACNY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 30/154 (19%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 32/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.