DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and crispld1b

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_009296842.1 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:160 Identity:42/160 - (26%)
Similarity:74/160 - (46%) Gaps:34/160 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AQQFEQEVLQAHN-----LYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIY 62
            :|...|.:|..||     :|......:.:....:|.|.|..||:..|..:...|.. :..|:|:.
Zfish    59 SQSDMQLILDLHNKLRGQVYPPASNMEYMVWDTELERSAEHWAHTCLWEHGPSHLL-TRIGQNLG 122

  Fly    63 MASGGNLKGADAVRSWYEEIRQYNWNSPSFQGN-------TG----HFTQVVWKSSTELGVG--- 113
            ...|.:......|::||:|:|.:::..|. :.|       :|    |:||:||.:|.::|..   
Zfish   123 AHWGRDRPPTFHVQAWYDEVRDFSYPYPQ-ECNPHCPYRCSGPVCTHYTQLVWATSNKIGCAINV 186

  Fly   114 ----------FAKSGSTIYVVCNYNPPGNY 133
                      :||:   :|:||||:||||:
Zfish   187 CYNMNVWGMIWAKA---VYLVCNYSPPGNW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 33/148 (22%)
crispld1bXP_009296842.1 SCP_euk 64..208 CDD:240180 36/148 (24%)
LCCL 301..385 CDD:128866
LCCL 404..501 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.