DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG6628

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:169 Identity:34/169 - (20%)
Similarity:69/169 - (40%) Gaps:57/169 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAKHGAQPLTLSPKLNRLAT-EWANYLLSRNRMEHRQ---------------NSGYG 58
            :|..||..|....:..:...||.:|:|| :|.:.|.....:..:|               ||  |
  Fly    72 ILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNS--G 134

  Fly    59 ENIYMAS------GGN------LKGADAVRSWY--------EEIRQYNWNSPSFQGNTG----HF 99
            :|:.:.:      .||      :|  :::..|:        |:::::.      :|..|    :|
  Fly   135 QNLALVNITLLPEDGNHTDECLVK--ESIGGWWNQSINITKEQLQRFP------KGKLGDSIRNF 191

  Fly   100 TQVVWKSSTELG---VGFAK-SGSTIYVV-CNYNPPGNY 133
            ..:...::|.:|   :.|.| :|..:::: |||  ..||
  Fly   192 AVMARDNNTHVGCAALRFEKPAGHPLFLLACNY--ASNY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 29/159 (18%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/164 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.