DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:146 Identity:40/146 - (27%)
Similarity:63/146 - (43%) Gaps:20/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FEQEVLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWA-------NYLLSRNRMEHRQNSGYG 58
            |..|.:..||..|..     ...:.:|....|:|.|..|.       |..|.:....|...:..|
  Rat    52 FINEYVNLHNELRGTVFPPGVNLRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESHPVFTDIG 116

  Fly    59 ENIYMASGGNLKGADAVRSWYEEIRQYNW-NSPSFQG-NTGHFTQVVWKSSTELGVGF---AKSG 118
            ||:::....:....:|:|||:||.:.||: |....:. :..|:.|:||..|.::|...   ||.|
  Rat   117 ENMWVGPEKDFTATNAIRSWHEERKSYNYVNDTCIEDEDCSHYIQLVWDHSYKVGCAVTPCAKVG 181

  Fly   119 STIYV---VCNYNPPG 131
            :..|.   :|||.|.|
  Rat   182 AITYAALFICNYAPGG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 35/138 (25%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 39/144 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.