DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and R3hdml

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:152 Identity:46/152 - (30%)
Similarity:65/152 - (42%) Gaps:32/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWANYLLSRNRMEH--RQNSGY-GENIYMASG 66
            :|..||..||.     ...:.:....:|.|.|..||...:    ..|  .|.:.| |:|:.:.||
  Rat    66 LLDYHNHIRASVHPPASNMEYMVWDEQLARAAEAWATQCI----WAHGPSQLTKYVGQNLSVHSG 126

  Fly    67 GNLKGADAVRSWYEEIRQYNWNSPS---------FQGNT-GHFTQVVWKSSTELGVGFAKS---- 117
            ......|.|:||.||.|.|::.:|.         ..|.. .|:||:||.||:.||......    
  Rat   127 RYRSVVDLVKSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAIHTCSSIN 191

  Fly   118 --GST----IYVVCNYNPPGNY 133
              |||    :|:||||...||:
  Rat   192 VWGSTWQQAVYLVCNYAIKGNW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 40/142 (28%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 42/144 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.