powered by:
Protein Alignment CG16995 and CG17574
DIOPT Version :9
Sequence 1: | NP_608668.2 |
Gene: | CG16995 / 33413 |
FlyBaseID: | FBgn0031412 |
Length: | 146 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246287.1 |
Gene: | CG17574 / 36415 |
FlyBaseID: | FBgn0033777 |
Length: | 175 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 15/64 - (23%) |
Similarity: | 23/64 - (35%) |
Gaps: | 17/64 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 FTQVVW-----------KSSTELGVGFAKSGSTI---YVVCNYNPPGNY--NNLFRENVAPPMQ 146
|...:| ::.||..|....:..|. |.|....||| | :|.:....:.|:|
Fly 32 FMLFIWGYCKCCCSCCKRNKTEAPVVVTSATHTAPGGYPVTQLPPPG-YPSSNAYVTATSYPVQ 94
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16995 | NP_608668.2 |
SCP_GAPR-1_like |
5..125 |
CDD:240182 |
7/39 (18%) |
CG17574 | NP_001246287.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.