DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG17574

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001246287.1 Gene:CG17574 / 36415 FlyBaseID:FBgn0033777 Length:175 Species:Drosophila melanogaster


Alignment Length:64 Identity:15/64 - (23%)
Similarity:23/64 - (35%) Gaps:17/64 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 FTQVVW-----------KSSTELGVGFAKSGSTI---YVVCNYNPPGNY--NNLFRENVAPPMQ 146
            |...:|           ::.||..|....:..|.   |.|....||| |  :|.:....:.|:|
  Fly    32 FMLFIWGYCKCCCSCCKRNKTEAPVVVTSATHTAPGGYPVTQLPPPG-YPSSNAYVTATSYPVQ 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 7/39 (18%)
CG17574NP_001246287.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.