DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG10651

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:159 Identity:33/159 - (20%)
Similarity:58/159 - (36%) Gaps:52/159 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAKHGAQPLTLSPKLNRLAT-EWANYLLS------------RNRMEHRQNSGYGENI 61
            ::..||.||.|. |..:..:||..|:.| ||...|..            |::.....|.|:.|..
  Fly    64 IVDKHNEYRNKF-AGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVS 127

  Fly    62 Y-------MASGGNLKGADAVRS----WY-----EEIRQ--YNWNSPSFQGNTGHFTQVVWKSST 108
            |       |.:     ..:|:|.    |:     :|:::  ::|.....:.:..:| ||:...:.
  Fly   128 YSLEKYFCMTT-----KKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYF-QVLRDRAN 186

  Fly   109 ELGVGFAKSGSTIYV---------VCNYN 128
            .:|....:     ||         .|.||
  Fly   187 RVGCAIVE-----YVRPALVHQLLKCVYN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 30/154 (19%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 31/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455104
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.