DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG4270

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:141 Identity:69/141 - (48%)
Similarity:90/141 - (63%) Gaps:1/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMASGGNLK 70
            |.:||....|.|||.||...:|::..||:||.||||:|..:|.|.||.|..|||||:::.|.::.
  Fly    31 FLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMDVT 95

  Fly    71 GADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKSGSTIYVVCNYNPPGNYNN 135
            |...|..||.||..|::|...|....|||||::||||.|:|.|.|:.....:||||||||||...
  Fly    96 GDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTWVVCNYNPPGNVVG 160

  Fly   136 LFRENVAPPMQ 146
            ||::|| ||.|
  Fly   161 LFKDNV-PPKQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 53/118 (45%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 61/126 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451918
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H116686
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
1413.840

Return to query results.
Submit another query.