DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and glipr2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_021327299.1 Gene:glipr2 / 325699 ZFINID:ZDB-GENE-030131-4424 Length:543 Species:Danio rerio


Alignment Length:148 Identity:78/148 - (52%)
Similarity:93/148 - (62%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMA- 64
            |:...||.|.||.||.||.:|||.|||.:..|.|.|.:||.:|||...:.| .|.|||||:|.| 
Zfish     1 MAGTSFEAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAH-SNKGYGENLYYAW 64

  Fly    65 SGGN--LKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKSGSTIYVVCNY 127
            |..|  |.|.:||.|||.||:.||::.|.|...||||||||||.:.|||||.|..|:||:||..|
Zfish    65 SSANKKLTGNEAVDSWYGEIKDYNFSRPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFVVGQY 129

  Fly   128 NPPGNYNN--LFRENVAP 143
            .|.||..|  .|.:||.|
Zfish   130 LPAGNIANAGYFEKNVLP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 67/122 (55%)
glipr2XP_021327299.1 SCP_GAPR-1_like 5..135 CDD:240182 71/130 (55%)
SCP_GAPR-1_like 196..326 CDD:240182
SCP_GAPR-1_like 397..528 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582476
Domainoid 1 1.000 129 1.000 Domainoid score I5194
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.