DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG9400

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:172 Identity:47/172 - (27%)
Similarity:68/172 - (39%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AQQFEQEVLQAHNLYRAK------HGAQPLTLSPKLNRLATE---WANYLLSRNRMEH---RQNS 55
            :::..|.:|..|||.|:|      .|.:.....|.| |..||   .|.....|.:..|   |...
  Fly    92 SERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLL-RWDTELEQMAALHAKRCQFAHDKCRNTP 155

  Fly    56 GY---GENI-YMASGGNLKG-----ADAVRSWYEEIRQYNWN-----SPSFQG-NTGHFTQVVWK 105
            .:   |:|| |...|...|.     ...|.:|:.|.:..|.:     .|..|| ..||||.:|..
  Fly   156 RFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSD 220

  Fly   106 SSTEL---GVGFAKSGSTIY---VVCNYNPPGNYNNLFRENV 141
            ....:   ||.|.:..|..:   :.|||    :|||:|.|.:
  Fly   221 RVNRVGCAGVRFLEPKSNRFQFMLTCNY----DYNNIFNEPI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 39/152 (26%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 42/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
54.950

Return to query results.
Submit another query.