DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG31286

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:141 Identity:44/141 - (31%)
Similarity:69/141 - (48%) Gaps:16/141 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRN---RMEHRQNSGYGENI--YMASGGNL 69
            ||:..|..|.:||...|||...|::....:| :.||::   ......|..|.|:|  :....|.|
  Fly    32 VLREINKRRDRHGVPKLTLDNVLSKGCQSYA-WKLSKSATLNYSDPTNKDYTESICRFEVKRGAL 95

  Fly    70 KGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAKSGST--IYVVCNYNPPGN 132
              :..|::||.. |:::...|..:    .||.::|:||..||.|.|...:.  ::|| .|.||||
  Fly    96 --SRCVKNWYNG-RKFDILDPKAK----DFTAMIWRSSVSLGYGDANINALQGVFVV-RYTPPGN 152

  Fly   133 YNNLFRENVAP 143
            ...|:.:||.|
  Fly   153 VKGLYTDNVPP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 34/121 (28%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 39/129 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.