DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG32313

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster


Alignment Length:146 Identity:47/146 - (32%)
Similarity:69/146 - (47%) Gaps:25/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMASGGNLK---- 70
            :|:|||..|||:|.||:.|..:|....:|:|:.:: ||...:.:|  |.|.:|.....:.|    
  Fly    27 ILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIV-RNEGVYTEN--YLEYLYATDPISAKHLQV 88

  Fly    71 --------GADAVRSWYEEIRQYNWNSPSFQGNTGH--FTQVVWKSSTELGVGFAKSGSTIYVVC 125
                    ..:.||.|:    .|.    .|..||.:  ||.::|.:||.||||..:...|.|:|.
  Fly    89 VCVFREALPRECVRIWF----HYR----GFAENTKYYRFTAMIWNASTRLGVGLGRIQETRYLVV 145

  Fly   126 NYNPPGNYNNLFRENV 141
            .|.||||.......||
  Fly   146 RYAPPGNILREMASNV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 39/128 (30%)
CG32313NP_001261262.1 SCP 27..153 CDD:294090 44/136 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.