DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Clec18a

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:146 Identity:38/146 - (26%)
Similarity:59/146 - (40%) Gaps:29/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAKHGAQPLTLSPK-LNRLATEWANYL--LSRNR-------------MEHRQNSGYG 58
            :|..||..|::       :.|. .|....:|:..|  |::.|             ...|.....|
  Rat    78 ILTTHNRLRSQ-------VHPSAANMQRMDWSESLAQLAQARAALCGTSATPNLAATLRNTPDVG 135

  Fly    59 ENIYMASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNT--GHFTQVVWKSSTELGVG----FAKS 117
            .|:.:...|:....:.|..|:.|..||...|.....|.  .|:||:||.:|::||.|    |...
  Rat   136 WNVQLLPMGSASFVEVVNVWFAEGLQYRHGSAECAHNATCAHYTQLVWATSSQLGCGWQPCFVDQ 200

  Fly   118 GSTIYVVCNYNPPGNY 133
            .:|...||.|:|.||:
  Rat   201 VATEAFVCAYSPGGNW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 32/136 (24%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 34/139 (24%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.