DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Pi15

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:158 Identity:39/158 - (24%)
Similarity:60/158 - (37%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWA---------NYLLSRNRMEHRQNSGYGEN 60
            :|..||..|.|     ...:.:.....|.:.|..||         :|||          ...|:|
  Rat    70 ILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLL----------RFLGQN 124

  Fly    61 IYMASGGNLKGADAVRSWYEEIRQYNWNSPS----------FQGNTGHFTQVVWKSSTELGVGFA 115
            :.:.:|........|:.||:|::.|.:..|.          |.....|:||:||.:|..:|....
  Rat   125 LSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIH 189

  Fly   116 KS------GS----TIYVVCNYNPPGNY 133
            ..      ||    .:|:||||.|.||:
  Rat   190 TCQNMNVWGSVWRRAVYLVCNYAPKGNW 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 32/148 (22%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 35/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.