DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Pi16

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:144 Identity:38/144 - (26%)
Similarity:65/144 - (45%) Gaps:24/144 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRM--------EHRQNSGYGENIYM 63
            :|.:::.||.|||:  ..|    |..:.|...|.:.|.:..:.        .:::....|||::.
  Rat    39 KQTMVELHNHYRAQ--VSP----PASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFA 97

  Fly    64 ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGN--TGHFTQVVWKSSTELGVGF--------AKSG 118
            .:...:....||.:|:||...||.::.:....  .||:|||||..:..:|.|.        .:..
  Rat    98 ITDEGMDVPLAVGNWHEEHEYYNLSTATCDPGQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEA 162

  Fly   119 STIYVVCNYNPPGN 132
            :...:||||.||||
  Rat   163 NIHLLVCNYEPPGN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 30/135 (22%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.