DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Pi16

DIOPT Version :10

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:144 Identity:38/144 - (26%)
Similarity:65/144 - (45%) Gaps:24/144 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRM--------EHRQNSGYGENIYM 63
            :|.:::.||.|||:  ..|    |..:.|...|.:.|.:..:.        .:::....|||::.
  Rat    39 KQTMVELHNHYRAQ--VSP----PASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFA 97

  Fly    64 ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGN--TGHFTQVVWKSSTELGVGF--------AKSG 118
            .:...:....||.:|:||...||.::.:....  .||:|||||..:..:|.|.        .:..
  Rat    98 ITDEGMDVPLAVGNWHEEHEYYNLSTATCDPGQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEA 162

  Fly   119 STIYVVCNYNPPGN 132
            :...:||||.||||
  Rat   163 NIHLLVCNYEPPGN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 CAP_GAPR1-like 5..125 CDD:349401 30/135 (22%)
Pi16NP_001163952.1 CAP_PI16_HrTT-1 39..172 CDD:349405 33/138 (24%)
PHA03247 <205..459 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.