DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and F09B9.5

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001024544.1 Gene:F09B9.5 / 259721 WormBaseID:WBGene00008604 Length:184 Species:Caenorhabditis elegans


Alignment Length:177 Identity:51/177 - (28%)
Similarity:80/177 - (45%) Gaps:36/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMASGGN 68
            ::|..::|..||..|..|.|..|..|.:|:.:|.:||:.|..:..:...:.||.||||.... .:
 Worm     8 KEFVDQMLLEHNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFSELSGIGENITFFP-PD 71

  Fly    69 LKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFA------------------ 115
            :.....|..||:|..:|.:.:|.:|..|.:||||:|:|:.|:|||.|                  
 Worm    72 IDAESVVEHWYQEHEKYEYETPGWQTGTNYFTQVIWRSTKEIGVGCAYVRKSHENDEDNTSCSNG 136

  Fly   116 ---KSGSTI------------YVVCNYNPPGNYN--NLFRENVAPPM 145
               ||.:::            .:|..|.|.||.|  ..|..||..|:
 Worm   137 SVCKSMTSLSSNGKLAAEGDKVIVAFYRPAGNNNRSGQFASNVLKPI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 41/152 (27%)
F09B9.5NP_001024544.1 CAP_GAPR1-like 9..168 CDD:349401 44/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I5819
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3781
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.