powered by:
Protein Alignment CG16995 and antr
DIOPT Version :9
Sequence 1: | NP_608668.2 |
Gene: | CG16995 / 33413 |
FlyBaseID: | FBgn0031412 |
Length: | 146 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246284.1 |
Gene: | antr / 246647 |
FlyBaseID: | FBgn0050488 |
Length: | 272 |
Species: | Drosophila melanogaster |
Alignment Length: | 54 |
Identity: | 13/54 - (24%) |
Similarity: | 25/54 - (46%) |
Gaps: | 8/54 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 GHFTQVVWKSSTELGVGFAKSG-----STIYVVCNYNPPGNYNNL--FRENVAP 143
||:..::....:.:|.|....| |.|.::|::: ..:.||| :.|...|
Fly 177 GHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFS-RASVNNLVPYEEGQIP 229
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45455087 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.