DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and D2062.1

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 / 24104374 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans


Alignment Length:158 Identity:54/158 - (34%)
Similarity:80/158 - (50%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYM--ASG- 66
            :.::.::..|||||:||||.||...|.::..|..||:.:.....:.|.:...||||:.|  .|| 
 Worm    46 KLKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAKSGWISHEKPRKYGENVAMFCQSGC 110

  Fly    67 ----GNLKGADAVRSWYEEIRQYNWNS--PSFQGNTGHFTQVVWKSSTELGVGFA--KSGS---- 119
                ..|..| .|..:|.|...|:::|  |......|||||:|||||.::|||.:  ||..    
 Worm   111 WPLPQTLAQA-MVHLFYIEGIGYDYSSFKPELLKENGHFTQIVWKSSRKIGVGISIGKSSQPPYI 174

  Fly   120 -TIYVVCNYNPPGNY--NNLFRENVAPP 144
             |::....::||||.  ...:..||..|
 Worm   175 PTMFHCVKFDPPGNVLAQQYYLSNVQRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 47/135 (35%)
D2062.1NP_001293506.1 CAP_GAPR1-like 46..189 CDD:349401 50/143 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.