DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and PI16

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001186088.1 Gene:PI16 / 221476 HGNCID:21245 Length:463 Species:Homo sapiens


Alignment Length:138 Identity:40/138 - (28%)
Similarity:65/138 - (47%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAKHGAQPLTLSPKLN-RLATEWANYLLSRNRM----EHRQNSGYGENIYMASGGNL 69
            :::.||||||:  ..| |.|..|: |...|.|.:..:..|.    .:::....|||::..:...:
Human    36 MVELHNLYRAQ--VSP-TASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRRGENLFAITDEGM 97

  Fly    70 KGADAVRSWYEEIRQYNWNSPSFQGN--TGHFTQVVWKSSTELGVG--FAKSGSTI------YVV 124
            ....|:..|:.|...||.::.:....  .||:|||||..:..:|.|  |.:....:      .:|
Human    98 DVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLV 162

  Fly   125 CNYNPPGN 132
            |||.||||
Human   163 CNYEPPGN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 32/129 (25%)
PI16NP_001186088.1 SCP_HrTT-1 33..166 CDD:240186 35/132 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..408
O-glycosylated at one site 386..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.