DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Crisp2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:156 Identity:46/156 - (29%)
Similarity:78/156 - (50%) Gaps:21/156 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFEQEVLQAHNLYRAK---HGAQPLTL--SPKLNRLATEWAN-YLLSRNRMEHRQ-NSGYGENIY 62
            |.::|::..||..|..   .|:..|.:  |.:....|.:||| .:|..:..:.|: |...|||:|
Mouse    36 QVQREIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLY 100

  Fly    63 MASGGNLKGADAVRSWYEEIRQYNWN---SPSFQGNTGHFTQVVWKSSTELGVGFA----KSGST 120
            |::...| .:..::|||.|...:.:.   .|:  ...||:||:||.||.::|.|.|    :....
Mouse   101 MSTDPTL-WSTVIQSWYNENEDFVYGVGAKPN--SAVGHYTQLVWYSSFKIGCGIAYCPNQDNLK 162

  Fly   121 IYVVCNYNPPGNYNNLFRENVAPPMQ 146
            .:.||:|.|.|  ||:.:::.  |.|
Mouse   163 YFYVCHYCPMG--NNVMKKST--PYQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 37/133 (28%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 40/137 (29%)
Crisp 189..243 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.