DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and scl-12

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_504056.1 Gene:scl-12 / 186714 WormBaseID:WBGene00019178 Length:208 Species:Caenorhabditis elegans


Alignment Length:153 Identity:37/153 - (24%)
Similarity:59/153 - (38%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRA-----KHGAQPLTLSPKLNRLATEWANYLLSRNRM------EHRQNSGYGENIYM 63
            :::|||..|:     .:.|......|..|....:|.:.:.|..:.      :....:.||||:|.
 Worm    26 IVKAHNDLRSAIALGNYDAAGTIEPPAANMRKIKWDSTVASSAQQYANTCPDDHSGTEYGENLYW 90

  Fly    64 ASGGNLK------GADAVRSWYEEIRQYNWNS-----PSFQGNTGHFTQVVWKSSTELGVGFAKS 117
            :...:..      |..|..||.:|.:.|.|.|     ..|....||.||:.|..:.::|.|....
 Worm    91 SWSSSAPTSLDKFGVAASNSWEKEFQDYGWESTYMDADLFDSGIGHATQMAWAETNKIGCGVKNC 155

  Fly   118 GS--------TIYVVCNYNPPGN 132
            |.        .:.|||.|:..||
 Worm   156 GKDSSMNNMYKVAVVCQYDQAGN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 32/144 (22%)
scl-12NP_504056.1 SCP 21..175 CDD:214553 35/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.