DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and F57B7.2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:149 Identity:46/149 - (30%)
Similarity:75/149 - (50%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMAS 65
            :|...|::..|.|||..|.::|.:.|..|.:|..:|..||..|..|.|:.:.:..|.|||:.:..
 Worm   149 LSEVNFQRSCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYPELPGIGENLILKE 213

  Fly    66 GGNLK----GADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVG--FAKSGSTIYVV 124
            .....    |.:.::.|.:|.:.::::.|.:......|:|||||.:||||..  :..:.:.:.||
 Worm   214 ANEQSHLPTGQEVIQEWEKEAQFFDFDKPRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVV 278

  Fly   125 CNYNPPGNYN--NLFRENV 141
            |.|.|.||.|  ..|..||
 Worm   279 CFYRPAGNSNAPGEFASNV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 35/125 (28%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.