DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and scl-9

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_502497.1 Gene:scl-9 / 186048 WormBaseID:WBGene00009890 Length:213 Species:Caenorhabditis elegans


Alignment Length:173 Identity:41/173 - (23%)
Similarity:67/173 - (38%) Gaps:45/173 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AQQFEQE----VLQAHNLYRAKHGAQPLTL----------------SPKLNRLATEWANYLLSRN 47
            :..|.:|    :|..||.:|::.....|:.                |.||...||::|. ...:|
 Worm    17 SDNFSKEGQLNLLNVHNEFRSQLALGQLSFRGVKKPSASMMRKISWSKKLTNAATKFAE-TCPKN 80

  Fly    48 RMEHRQNSGYGENIYMASGGNLKGAD-----AVRSWYEEIRQYNW-----NSPSFQGNTGHFTQV 102
               |......||:|:.....:|...:     |.:.|:.|.....|     |..|.:...||..|:
 Worm    81 ---HSVVMNTGESIFWHFSSSLSTPEQYATLAPQKWWNEFETNGWDSLIYNHASQRFQIGHAVQM 142

  Fly   103 VWKSSTELGVGFAKSG-----STIYVVCNYNPPGN------YN 134
            .|.:::::|.|::|..     .|:.|||.|...||      ||
 Worm   143 AWHTTSKVGCGYSKCAVGTPEQTMVVVCRYFQKGNIEGEPIYN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 34/154 (22%)
scl-9NP_502497.1 SCP 23..174 CDD:214553 36/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.