DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and scl-8

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_502510.1 Gene:scl-8 / 183345 WormBaseID:WBGene00008030 Length:210 Species:Caenorhabditis elegans


Alignment Length:167 Identity:47/167 - (28%)
Similarity:70/167 - (41%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQEVLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWANYL--LSRN-----RMEHRQN-SGYG 58
            :|.:|.|||..|::     :.|:........|.|..:|.:.|  .::|     .|:|..| ...|
 Worm    23 KQSILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGCHMQHSTNDKTIG 87

  Fly    59 ENIYMA-SGGNLKGAD-----AVRSWYEEIRQYNWNSPSFQ---GNTG--HFTQVVWKSSTELGV 112
            ||:|.. ||......|     |..:|..|..|:.|||..|.   .|||  |.||:.|..:.::|.
 Worm    88 ENLYWEWSGDPFSDLDKFGKIATVAWDHEFEQFGWNSNKFSLALFNTGVAHATQIAWAPTGKIGC 152

  Fly   113 GFAKSGS--------TIYVVCNYNPPGNYNNLFRENV 141
            |....|.        .:.:||.|...||:   |.:|:
 Worm   153 GVKNCGRDARRGGLFQVAIVCQYRVRGNF---FFKNI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 40/149 (27%)
scl-8NP_502510.1 SCP 22..175 CDD:214553 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161861
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.