DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and C07A4.2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:166 Identity:54/166 - (32%)
Similarity:83/166 - (50%) Gaps:25/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYL-LSRNRMEHRQNSGYGENIYMASGGN 68
            :.::.::..||:||:||||..|.....|:.....||:.| ..:..:.|.|...||||::.....:
 Worm   251 KLKEWLVSYHNVYRSKHGAPALISDSVLDSRGKRWADELAYHKGCLVHEQPRTYGENLFFFGARH 315

  Fly    69 LK-----GADAVRSWYEEIRQYNWNS--PSFQGNTGHFTQVVWKSSTELGVG--FAKSGST---- 120
            |.     .|..::|:|.|...||::|  |.....||||||::||:|.::|||  ..||.|.    
 Worm   316 LPSPQTLAAAVIQSFYLEGIGYNYSSWRPMSFFKTGHFTQLIWKNSRKIGVGVSIVKSSSIRSPC 380

  Fly   121 ---------IYVVCNYNPPGNY--NNLFRENVAPPM 145
                     ||||..|:|.||:  :..:..||..|:
 Worm   381 VSSSPNMYFIYVVVKYDPAGNFESHKAYLNNVERPV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 46/142 (32%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 50/150 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161886
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.