DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and vap-2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:159 Identity:45/159 - (28%)
Similarity:66/159 - (41%) Gaps:38/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LQAHNLYRAK------HGAQPLTLSPK------------LNRLATEWANYLLSRNRMEHRQNSGY 57
            |:.||.||::      ...:..|..||            |.|.|..|||..:..: ..|.:....
 Worm   320 LEQHNFYRSRLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAH-SAHYERPNQ 383

  Fly    58 GENIYMASGGNLKGAD----AVRSWYEEIRQYN-----------WNSPSFQGNT-GHFTQVVWKS 106
            |:|:||:|..|.....    ||..|::|:.::.           |:   .:|.. ||:||:.|..
 Worm   384 GQNLYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWD---LKGKAIGHYTQMAWDR 445

  Fly   107 STELGVGFAKSGSTIYVVCNYNPPGNYNN 135
            :..||.|.|......||||:|.|.||..|
 Worm   446 TYRLGCGIANCPKMSYVVCHYGPAGNRKN 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 38/147 (26%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 41/151 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.