DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and scl-3

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_502504.1 Gene:scl-3 / 178252 WormBaseID:WBGene00009896 Length:211 Species:Caenorhabditis elegans


Alignment Length:163 Identity:46/163 - (28%)
Similarity:68/163 - (41%) Gaps:34/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAQQFEQEVLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWANYLLSRNR-------MEHRQN 54
            |.|||   ::..||..|..     :.|:..|.:...|.|..:|...|.:..:       ..|...
 Worm    23 STQQF---IVDLHNKLRTSIAKGTYVAKGTTKAAGSNLLKMKWDTTLATAAQTFANTCPRGHSNA 84

  Fly    55 SGYGENIYMA------SGGNLKGADAVRSWYEEIRQYNWNSPSFQ---GNT--GHFTQVVWKSST 108
            :|.|||:|..      ||.::.|..|..:|.:|.:||.|.:.:|.   .||  ||.||:.|.::.
 Worm    85 AGVGENLYWRWSSLPFSGMDIYGGAASVAWEQEFQQYGWTTNTFTQALANTGIGHATQMAWANTG 149

  Fly   109 ELGVGFAKSG--------STIYVVCNYNPPGNY 133
            .:|.|....|        :...|||.|...|||
 Worm   150 LIGCGVKNCGPDPELNNYNRAVVVCQYKAQGNY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 38/150 (25%)
scl-3NP_502504.1 SCP 23..176 CDD:214553 42/155 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.