DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and Crispld2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:155 Identity:45/155 - (29%)
Similarity:71/155 - (45%) Gaps:34/155 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QEVLQAHN-----LYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNS---GYGENIYMA 64
            ||:|..||     :|......:.:|...:|.|.|..||...|    .||...|   ..|:|:.:.
  Rat    57 QEILMLHNKLRGQVYPPASNMEYMTWDEELERSAAAWAQRCL----WEHGPASLLVSIGQNLAVH 117

  Fly    65 SGGNLKGADAVRSWYEEIRQYNWNSPSFQGN-------TG----HFTQVVWKSSTELG--VGFAK 116
            .|........|:|||:|::.|.:..| .:.|       :|    |:||:||.::.::|  |...:
  Rat   118 WGRYRSPGFHVQSWYDEVKDYTYPYP-HECNPWCPERCSGAMCTHYTQMVWATTNKIGCAVHTCR 181

  Fly   117 SGS--------TIYVVCNYNPPGNY 133
            |.|        .:|:||||:|.||:
  Rat   182 SMSVWGDIWENAVYLVCNYSPKGNW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 38/145 (26%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 41/148 (28%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.