DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and GLIPR2

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:149 Identity:64/149 - (42%)
Similarity:85/149 - (57%) Gaps:7/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSG---YGENIYM 63
            :::||..|||:|||.||.|||..||.|...|||.|.:::..|.|...::|...|.   .|||:..
Human    20 ASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAW 84

  Fly    64 ASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFAK-SGSTIYVVCNY 127
            || .:..|.:....||.||:.||:..|.|...|||||.:|||::.::|||.|. |..:.:||..|
Human    85 AS-YDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARY 148

  Fly   128 NPPGNYNN--LFRENVAPP 144
            .|.||..|  .|.|||.||
Human   149 FPAGNVVNEGFFEENVLPP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 52/123 (42%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 56/131 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.