DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and CG43777

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:88 Identity:24/88 - (27%)
Similarity:41/88 - (46%) Gaps:20/88 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGYGENIYMASGGNLKGADAVRSWYEEIRQY 85
            |.:.|..:  ::.::|.:..|.|  ||:.     :| ||   :.:.||...|.|.|     :||.
  Fly    54 HASVPNNM--RMQKIALDILNNL--RNKF-----AG-GE---LRTKGNKTFAKARR-----MRQL 100

  Fly    86 NWNSP-SFQGNTGHFTQVVWKSS 107
            .|:.. ::.|| .|.:.:..|||
  Fly   101 FWDKELAYMGN-NHASTLSLKSS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 24/88 (27%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455101
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
54.940

Return to query results.
Submit another query.