DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and R3HDML

DIOPT Version :9

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_848586.1 Gene:R3HDML / 140902 HGNCID:16249 Length:253 Species:Homo sapiens


Alignment Length:152 Identity:43/152 - (28%)
Similarity:59/152 - (38%) Gaps:32/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLQAHNLYRAK-----HGAQPLTLSPKLNRLATEWANYLLSRNRMEH--RQNSGY-GENIYMASG 66
            :|..||..||.     ...:.:....:|.|.|..||...:    ..|  .|...| |:|:.:.||
Human    66 LLDYHNHIRASVYPPAANMEYMVWDKRLARAAEAWATQCI----WAHGPSQLMRYVGQNLSIHSG 126

  Fly    67 GNLKGADAVRSWYEEIRQYNWNSP---------SFQGNT-GHFTQVVWKSSTELGVGFAKSGS-- 119
            ......|.::||.||...|.:.:|         ...|.| .|:||:||.||..||.......|  
Human   127 QYRSVVDLMKSWSEEKWHYLFPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRLGCAIHTCSSIS 191

  Fly   120 --------TIYVVCNYNPPGNY 133
                    ..|:||||...||:
Human   192 VWGNTWHRAAYLVCNYAIKGNW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 37/142 (26%)
R3HDMLNP_848586.1 SCP 65..207 CDD:320774 39/144 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.