DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16995 and LOC1271900

DIOPT Version :10

Sequence 1:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_310755.6 Gene:LOC1271900 / 1271900 VectorBaseID:AGAMI1_007444 Length:262 Species:Anopheles gambiae


Alignment Length:75 Identity:18/75 - (24%)
Similarity:31/75 - (41%) Gaps:20/75 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WYEE--------IRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFA-----KSG---STIYVVCN 126
            ||.|        ::.|:.:|.|.:...|||.|::..:...:|....     :.|   .|..:.||
Mosquito   162 WYLEHEVTHPADVKHYSQHSSSRKFQIGHFLQLINCNVCRMGCSLVSYREHRKGLVCDTYILCCN 226

  Fly   127 YNPPGNYNNL 136
            |    :|.|:
Mosquito   227 Y----SYINI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16995NP_608668.2 CAP_GAPR1-like 5..125 CDD:349401 13/62 (21%)
LOC1271900XP_310755.6 None

Return to query results.
Submit another query.